Anti-Extracellular Signal-Regulated Kinases 1 and 2

Host: Rabbit

Isotype: IgG

Immunogen: a synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to amino acids 333-367 of rat ERK1 MAP kinase with the CGG spacer group added, conjugated to KLH

Form: Liquid

Formulation: In PBS, 50% glycerol.

Preservative: ≤0.1% sodium azide

Positive Control: Rat adipose, brain, heart, intestine, kidney, liver, lung, muscle, spleen, testis or thymus tissue

Comments: Recognizes the ~44 kDa ERK1 and the ~42 kDa ERK2 proteins in rat adipose brain, and heart tissue.

Ref.: Hardie, F. and Hanks, S. 1995. in The Protein Kinase Facts Book p. 418, Academic Press, San Diego, CA. Charest, D.L., et al. 1993. Mol. Cell Biol. 13, 4679. Boulton, T.G., et al. 1990. Science 249, 64.